Tumblelog by Soup.io
Newer posts are loading.
You are at the newest post.
Click here to check if anything new just came in.

January 26 2011


Release: Froxlor-0.9.17

Froxlor 0.9.17 has been released, new customer-notification for diskspace/traffic usage and various minor bugfixes, see http://forum.froxlor.org/index.php?/topic/693-release-froxlor-0917/

November 29 2010


Release: Froxlor-0.9.15

Now supports Nginx webserver. Also includes many bugfixes, see http://bit.ly/fZc7Aj

October 25 2010


Release: Froxlor-0.9.14

Fixes various AWStats issues, new: domain-login, custom docroot for ip/port and much more, see http://bit.ly/bfC26e

October 01 2010


Release: Froxlor-

This fixes an issue in the support-ticket-system, more

September 27 2010


Release: Froxlor-0.9.13

Many minor bugfixes and improvements, see http://bit.ly/dB5NXx

August 23 2010


Release: Froxlor-0.9.12

Many improvements implemented and bugs fixed thx to the community, see http://bit.ly/cesgK8

July 26 2010


Release: Froxlor-0.9.11

Froxlor features Perl/CGI implementation and fixes some minor issues, see http://bit.ly/bj1ZBt

June 28 2010


Release: Froxlor-0.9.10

Uninstalling APS packages works correctly now, minor bugs fixed, see http://bit.ly/dARvHF

June 16 2010

4535 3540 500
Reposted byJaBBNukularFreXxXDerOrwischer

June 14 2010


Release: Froxlor-0.9.9

Implemented APS-1.2 standard, corrections in DNS and Webserver-config + some minor fixes, see http://bit.ly/bwhgQL

May 31 2010


Release: Froxlor-0.9.8

Some minor changes in dovecot/postfix- and libnss-configs, see http://bit.ly/aIig7W

May 19 2010

7074 d642
Reposted fromhirngulasch hirngulasch viaFreXxX FreXxX

May 17 2010


Release: Froxlor-0.9.7

An open_basedir security issues and a lot of other bugs have been fixed, see http://bit.ly/946zIK

May 03 2010


Release: Froxlor-0.9.6

You can now define default: error-pages, php-configs, ticket-priorities and TTL for domains; see http://bit.ly/dxejKo

April 05 2010


Release: Froxlor-0.9.4

Froxlor-0.9.4 has just been released, with refactored AWStats- and DomainKey-feature and a new translation, see http://bit.ly/caCqyp
Reposted byFreXxX FreXxX

March 24 2010

9865 c06d 500
Reposted byFreXxXDerOrwischerDowdlesmendelpascalmhfinkreghekeliasapzzOwlHoazlsicksinwstawieplywaizabasienazywasuppenkasperltales-of-a-librarianteddybaertrixeypixey

March 15 2010


Release: Froxlor-0.9.3

Froxlor-0.9.3 has just been released. Read more in the announcement: http://bit.ly/9Rkz9b

February 01 2010

The new server management panel Froxlor has been released

January 08 2010

Be-Sharps - Baby on Board (cover)
Reposted bybeatogether beatogether
Older posts are this way If this message doesn't go away, click anywhere on the page to continue loading posts.
Could not load more posts
Maybe Soup is currently being updated? I'll try again automatically in a few seconds...
Just a second, loading more posts...
You've reached the end.

Don't be the product, buy the product!
